anti-Mouse (Murine) PKC beta antibody for Western Blotting

Recommended PKC beta Antibody

Antigen
Protein Kinase C, beta (PRKCB) Antibodies
  • PKC-beta
  • PKCB
  • PRKCB1
  • PRKCB2
  • A130082F03Rik
  • PKC-Beta
  • Pkcb
  • Prkcb1
  • Prkcb2
  • PKC-B
  • Prkcb
  • prkcb1
  • zgc:63591
  • PKC
  • PRKCB_tv2
  • Pkc53E
  • prkcb1l
  • zgc:64063
  • protein kinase C beta
  • protein kinase C, beta
  • protein kinase C, beta b
  • protein kinase C, beta a
  • PRKCB
  • Prkcb
  • prkcbb
  • prkcba
Epitope
N-Term
33
22
21
15
15
13
11
9
9
8
8
7
6
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
230
176
164
21
19
15
10
5
4
2
2
2
2
1
1
1
Host
Rabbit
254
18
8
7
1
Clonality
Polyclonal
Conjugate
This PKC beta antibody is un-conjugated
22
15
8
8
8
7
7
7
7
6
6
6
2
1
1
1
1
1
Application
Western Blotting (WB)
222
122
106
27
24
17
14
14
11
8
8
4
3
3
1
1
Options

Available images

Catalog No. ABIN634421
$ 449.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
16.972363 ABIN634422 WB Rabbit N-Term Polyclonal 0
13.808898 ABIN2737417 IHC WB Rabbit IgG Polyclonal 0
13.163464 ABIN3186468 ELISA WB Rabbit IgG Thr290 Polyclonal 0
13.163464 ABIN3182327 ELISA IHC WB Rabbit IgG pSer661 Polyclonal 0
13.163464 ABIN2149136 ELISA WB Rabbit IgG pSer661 Polyclonal 0
10.808898 ABIN1870521 IF IHC WB Rabbit IgG pThr641 Polyclonal 0
10.808898 ABIN2987562 IF/ICC IHC WB Rabbit IgG pThr641 Polyclonal 0
10.808898 ABIN6568089 IHC WB Rabbit IgG Polyclonal 0
10.808898 ABIN6290747 IHC WB Rabbit IgG Polyclonal 0
10.808898 ABIN3032235 IHC ELISA WB Rabbit Ig Fraction AA 642-673 Polyclonal 0
9.308898 ABIN3043550 WB Rabbit IgG AA 542-671 Polyclonal 2
9.308898 ABIN2786693 WB Rabbit N-Term Polyclonal 1
7.808898 ABIN6271958 ELISA ICC IF WB Rabbit IgG pThr500 Polyclonal 0
7.808898 ABIN6255455 ELISA ICC IF WB Rabbit IgG pSer661 Polyclonal 0
7.808898 ABIN6264249 ELISA ICC IF WB Rabbit IgG Polyclonal 0
7.808898 ABIN6271222 ELISA IHC WB Rabbit IgG pSer660 Polyclonal 0
7.808898 ABIN4904860 IHC WB Rabbit IgG Polyclonal 0
7.808898 ABIN2998168 IHC WB Rabbit IgG Polyclonal 0
7.808898 ABIN2995246 IHC WB Rabbit IgG Polyclonal 0
7.808898 ABIN2424915 IF IHC WB Rabbit IgG pThr641 Polyclonal 0

General

Antigen Protein Kinase C, beta (PRKCB) Antibodies
Epitope N-Term
(33), (22), (21), (15), (15), (13), (11), (9), (9), (8), (8), (7), (6), (4), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(230), (176), (164), (21), (19), (15), (10), (5), (4), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(254), (18), (8), (7), (1)
Clonality
Polyclonal
Conjugate This PKC beta antibody is un-conjugated
(22), (15), (8), (8), (8), (7), (7), (7), (7), (6), (6), (6), (2), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(222), (122), (106), (27), (24), (17), (14), (14), (11), (8), (8), (4), (3), (3), (1), (1)
Supplier

Product Details anti-PKC beta Antibody

Target Details PKC beta Application Details Handling Images
Specificity PRKCB1 antibody was raised against the N terminal of PRKCB1
Purification Affinity purified
Immunogen PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC
Plasmids, Primers & others

Target Details PKC beta

Product Details anti-PKC beta Antibody Application Details Handling Images back to top
Antigen
Alternative Name PRKCB1 (PRKCB Antibody Abstract)
Background Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
Molecular Weight 77 kDa (MW of target protein)
Pathways WNT Signaling, TCR Signaling, Thyroid Hormone Synthesis, Nuclear Hormone Receptor Binding, Chromatin Binding, Myometrial Relaxation and Contraction, VEGF Signaling, Unfolded protein response

Application Details

Product Details anti-PKC beta Antibody Target Details PKC beta Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Restrictions For Research Use only

Handling

Product Details anti-PKC beta Antibody Target Details PKC beta Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-PKC beta Antibody Target Details PKC beta Application Details Handling back to top
Supplier Images
Image no. 1 for anti-Protein Kinase C, beta (PRKCB) (N-Term) antibody (ABIN634421) PRKCB1 antibody used at 1 ug/ml to detect target protein.