Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Defensin, beta 1 (DEFB1) (AA 1-36) antibody

Antigen

Defensin, beta 1 (DEFB1)

Synonyms BD1, HBD1, DEFB-1, DEFB101, MGC51822, mBD-1, AW260221, DEFB1, MGC140110, GAL3, GAL1, DEFB1-like, RHBD-1, Defb1, CBD1
Epitope
Alternatives

AA 1-36

Clonality Monoclonal (M4-14b-H4)
Host
Alternatives

Mouse

Reactivity
Alternatives

Human

Application
Alternatives ELISA, Western Blotting (WB)
Catalog no. ABIN109993
Quantity 10 µg  (Variants)
Price 166.40 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 3 to 5 Business days

Additional Information

Alternative name beta-Defensin 1 (aa 1-36)
Immunogen Synthetic human 61538-Defensin 1 (aa 1-36) (3 disulfide bridges)(dhyncvssggqclysacpiftkiqgtcyrgkakcck)
Isotype IgG1  (Matching secondary antibodies)
Clone M4-14b-H4
Description Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4
Specificity Synthetic human 61538-Defensin 1 (aa- 1-36)

Application Details

Application Notes ELISA, Western blot This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Storage 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided
Research Area Immunology
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Defensin, beta 1 (DEFB1)", type "Antibodies"
Hosts Rabbit (58), Mouse (4)
Reactivities Human (46), Mouse (Murine) (16), Rat (Rattus) (15), Monkey (1)
Applications Western Blotting (WB) (30), Flow Cytometry (FACS) (26), Immunofluorescence (IF) (26), ELISA (22), Enzyme Immunoassay (EIA) (12), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (4), Immunoprecipitation (IP) (4), Immunoelectron Microscopy (EM) (2), Radioimmunoassay (RIA) (2)
Conjugates Biotin (6), Alexa Flour 488 (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy7 (2), RBITC (2)
Epitopes AA 28-34 (5), AA 1-36 (4), AA 1-5 (4), AA 18-26 (4)