IVNS1ABP antibody (N-Term)
-
- Target See all IVNS1ABP Antibodies
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Cow, Zebrafish (Danio rerio), Pig, Xenopus laevis
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IVNS1ABP antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Sequence
- MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
- Cross-Reactivity (Details)
- Species reactivity (expected):Mouse, Dog, Rat, African clawed frog, Bovine, Pig, ZebrafishSpecies reactivity (tested):Human
- Purification
- Purified using Protein A affinity column
- Immunogen
- The immunogen for anti-IVNS1ABP antibody: synthetic peptide directed towards the N terminal of human IVNS1ABP.
- Top Product
- Discover our top product IVNS1ABP Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 100 μL of distilled water to a final concentration of 1 mg/mL.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or in aliquots at -20 °C long term.
-
- Target
- IVNS1ABP (Influenza Virus NS1A Binding Protein (IVNS1ABP))
- Alternative Name
- IVNS1ABP (IVNS1ABP Products)
- Target Type
- Influenza Protein
- Background
- This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.Synonyms: ARA3, Aryl hydrocarbon receptor-associated protein 3, FLARA3, HSPC068, Influenza virus NS1A-binding protein, KIAA0850, NS1, NS1-binding protein, NS1BP
- Gene ID
- 10625
- NCBI Accession
- NP_006460
- Pathways
- Negative Regulation of intrinsic apoptotic Signaling
-