IVNS1ABP antibody (Influenza Virus NS1A Binding Protein) (AA 1-100)

Details for Product anti-IVNS1ABP Antibody No. ABIN1327125
Target
Binding Specificity
AA 1-100
4
1
1
Reactivity
Human
9
6
4
4
4
4
3
3
2
2
2
2
1
1
1
Host
Mouse
10
Clonality (Clone)
Monoclonal ()
Application
ELISA, Western Blotting (WB)
10
7
3
3
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant IVNS1ABP.
Immunogen

immunogen: IVNS1ABP (NP_006460.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKE

Clone 4B1
Isotype IgG1 kappa
Cross-Reactivity Human
Target
Alternative Name IVNS1ABP (IVNS1ABP Antibody Abstract)
Background Full Gene Name: influenza virus NS1A binding protein
Synonyms: DKFZp686K06216,FLARA3,FLJ10069,FLJ10411,FLJ10962,FLJ35593,FLJ36593,HSPC068,KIAA0850,ND1,NS-1,NS1-BP,NS1BP
Gene ID 10625
NCBI Accession NP_006460, NM_006469
Pathways Negative Regulation of intrinsic apoptotic Signaling
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Influenza Virus NS1A Binding Protein (IVNS1ABP) (AA 1-100) antibody (ABIN1327125) Detection limit for recombinant GST tagged IVNS1ABP is 3 ng/ml as a capture antibody.