Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182313

Zinc Finger Protein 341 (ZNF341) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Znf341, ZFP341
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182313
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341
Sequence GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMT QHKNEQVYKC
Predicted Reactivity Human : 100%, Bovine : 85%, Dog : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF341. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ZNF341
Background The ZNF341 gene is located on chromosome 20.
Molecular Weight 92kDa
Gene ID 84905
NCBI Accession NP_116208, NM_032819
UniProt Q9BYN7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF341 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 341 (ZNF341)", type "Antibodies"
Hosts (10)
Reactivities (9), (3), (3), (3), (2)
Applications (8), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon