Zinc Finger Protein 341 (ZNF341) (Middle Region) antibody

Details for Product No. ABIN182313
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Znf341, ZFP341
Epitope
Middle Region
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(9), (3), (3), (3), (2)
Host
Rabbit
(9), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(8), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182313
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF341
Sequence GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMT QHKNEQVYKC
Predicted Reactivity Human : 100 %, Bovine : 80 %, Dog : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF341. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ZNF341
Background The ZNF341 gene is located on chromosome 20.
Molecular Weight 92 kDa
Gene ID 84905
NCBI Accession NM_032819, NP_116208
UniProt Q9BYN7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 847 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 341 (ZNF341) (Middle Region) antibody WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 341 (ZNF341) (Middle Region) antibody (2) anti-Zinc Finger Protein 341 (ZNF341) (Middle Region) antibody (Image 2)
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (9), (1)
Reactivities (9), (3), (3), (3), (2)
Applications (8), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top