Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

L(3)mbt-Like 2 (Drosophila) (L3MBTL2) antibody

Antigen

L(3)mbt-Like 2 (Drosophila) (L3MBTL2)

Synonyms L3MBT, H-l(3)mbt-l, M4mbt, MGC31247, 4732493N06Rik, MGC124862, L3MBTL2, MGC139186, MGC66491, zgc:66491, im:7137244, wu:fb04e09, DKFZp459I075
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Rat (Rattus), Fruit Fly (Drosophila melanogaster)

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182328
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name L3MBTL2
Gene ID L3MBTL2
Immunogen The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2
Sequence EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKA KEATKKKKKQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-L3MBTL2 antibody concentration is 1 mg/ml.
Description L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Characteristics Antigen Size: 705 amino acids
Molecular Weight 79kDa

Application Details

Application Notes WB Suggested Anti-L3MBTL2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "L(3)mbt-Like 2 (Drosophila) (L3MBTL2)", type "Antibodies"
Hosts Rabbit (8), Mouse (1)
Reactivities Human (9), Cow (Bovine) (4), Dog (Canine) (4), Rat (Rattus) (3), Mouse (Murine) (2), Fruit Fly (Drosophila melanogaster) (1)
Applications Western Blotting (WB) (9), ELISA (4), Immunohistochemistry (IHC) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes C-Term (3), N-Term (1)