Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) antibody

Antigen

General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2)

Synonyms AI326315, 1110031C13Rik, Rap30, RAP30, MGC75790, zgc:86775, wu:fb39a05, GTF2F2, MGC133695
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182366
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name GTF2F2
Gene ID GTF2F2
UniProt P13984
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2
Sequence IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKE DGKRARADKQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GTF2F2 antibody concentration is 1 mg/ml.
Description GTranscription Factor Antibodies2F2 is required for both basal and HIV-1 Tat-activated transcription. GTranscription Factor Antibodies2F2 synergizes with HIV-1 Tat and the cellular co-activator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter.
Characteristics Antigen Size: 249 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-GTF2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Heng, Xiao, Shi et al.: "Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome." in: Human molecular genetics, Vol. 3, Issue 1, pp. 61-4, 1994 (PubMed).

Alternatives

Alternatives for antigen "General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2)", type "Antibodies"
Hosts Rabbit (13), Mouse (1)
Reactivities Human (14), Mouse (Murine) (9), Rat (Rattus) (9), Dog (Canine) (6), Chicken (4), Cow (Bovine) (4), Xenopus laevis (3), Zebrafish (3), Cat (Feline) (1)
Applications Western Blotting (WB) (14), Immunohistochemistry (IHC) (7), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes Internal Region (2), C-Term (1)