Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182407

Zinc Finger Protein 609 (ZNF609) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1561651, Znf609, 9830165N24, BC016271, mKIAA0295, ZNF609
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182407
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF609 antibody: synthetic peptide directed towards the N terminal of human ZNF609
Sequence NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFT PSEGAASKKE
Predicted Reactivity Human : 100%, Bovine : 92%, Horse : 92%, Pig : 92%, Chicken : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF609. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF609
Background The function of ZNF609 remains unknown.
Molecular Weight 155kDa
Gene ID 23060
NCBI Accession NP_055857, NM_015042
UniProt O15014
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF609 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 609 (ZNF609)", type "Antibodies"
Hosts (2)
Reactivities (2)
Applications (2)
Epitopes (1)
Beacon