Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Pancreas Specific Transcription Factor, 1a (PTF1A) antibody

Antigen

Pancreas Specific Transcription Factor, 1a (PTF1A)
Synonyms bHLHa29, PTF1-p48, PTF1p48, PTF1, MGC112216, zgc:112216, si:zc142h2.2, PTF1A, XPtf1a, Ptf1a/p48
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182417
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Pancreas Specific Transcription Factor, 1a (PTF1A) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PTF1A
Gene ID PTF1A
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A
Sequence MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGD ELLADEQAEV
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-PTF1A antibody concentration is 1 mg/ml.
Description PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
Characteristics Antigen Size: 328 amino acids
Molecular Weight 35kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-PTF1A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Neurogenesis
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Gene expression patterns : GEP, Vol. 2, Issue 3-4, pp. 329-35, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Pancreas Specific Transcription Factor, 1a (PTF1A)", type "Antibodies"
Hosts Rabbit (26), Goat (9), Mouse (3)
Reactivities Human (34), Mouse (Murine) (21), Rat (Rattus) (21), Dog (Canine) (20), Zebrafish (Danio rerio) (3), Zebrafish (1)
Applications Western Blotting (WB) (19), ELISA (16), Immunofluorescence (IF) (15), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (2), N-Term (2), AA 1-92 (1), C-Term (1)