Hepatocyte Nuclear Factor 4, alpha (HNF4A) antibody

Antigen: Hepatocyte Nuclear Factor 4, alpha (HNF4A)

Synonyms: HNF4A, HNF4alpha, HNF-4alpha, DmHNF4, HNF-4, HNF-4(D), HNF4, Hnf-4h, NR2A4, dHNF-4, dHNF4, DmelCG9310, CG9310

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Pig (Porcine), Zebrafish, Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Chromatin Immunoprecipitation (ChiP)

Catalog no.: ABIN182453

Additional Information

Alternative name: HNF4 alpha / TCF14

Gene ID: HNF4A

Immunogen: The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the N terminal of human HNF4A

Sequence: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDT SPSEGTNLNA

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HNF4A antibody concentration is 1 mg/ml.

Description: The protein encoded by HNF4A is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I.

Characteristics: Antigen Size: 474 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Weedon, Owen, Shields et al.: "Common variants of the hepatocyte nuclear factor-4alpha P2 promoter are associated with type 2 diabetes in the U.K. population." in: Diabetes, Vol. 53, Issue 11, pp. 3002-6, 2004 (PubMed).

Schmidt, Wilson, Ballester et al.: "Five-vertebrate ChIP-seq reveals the evolutionary dynamics of transcription factor binding." in: Science (New York, N.Y.), Vol. 328, Issue 5981, pp. 1036-40, 2010 (PubMed).