Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6) antibody

Antigen: Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6)

Synonyms: EAR2, EAR-2, ERBAL2, Erbal2, AV090102, COUP-TF3, NR2F6, fc94g11, zgc:77259, wu:fc94g11, nr2f6, MGC69000, ear2, ear-2, erbal2, MGC69386

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN182517

Additional Information

Alternative name: NR2F6

Gene ID: NR2F6

UniProt: P10588

Immunogen: The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6

Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAAS DAEPGDEERP

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-NR2F6 antibody concentration is 1 mg/ml.

Description: NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily

Characteristics: Antigen Size: 404 amino acids

Molecular Weight: 43kDa

Application Details

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling

Restrictions: For Research Use only

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).