Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Sirtuin 5 (SIRT5) antibody

Antigen

Sirtuin 5 (SIRT5)

Synonyms SIR2L5, FLJ36950, AV001953, 0610012J09Rik, 1500032M05Rik, MGC93823, zgc:92288, SIRT5, MGC128489, sir2l5, DKFZp468D0719
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis, Chicken, Pig (Porcine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN182559
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SIRT5
Gene ID SIRT5
UniProt Q9NXA8
Immunogen The immunogen for anti-SIRT5 antibody: synthetic peptide directed towards the C terminal of human SIRT5
Sequence EVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE FNTETTPATN
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SIRT5 antibody concentration is 1 mg/ml.
Description SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.
Characteristics Antigen Size: 299 amino acids
Molecular Weight 32kDa

Application Details

Application Notes WB Suggested Anti-SIRT5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Proteases
Restrictions For Research Use only

Publications

Product Frye: "Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins." in: Biochemical and biophysical research communications, Vol. 273, Issue 2, pp. 793-8, 2000 (PubMed).

Alternatives

Alternatives for antigen "Sirtuin 5 (SIRT5)", type "Antibodies"
Hosts Rabbit (47), Mouse (12), Chicken (3), Sheep (1)
Reactivities Human (52), Mouse (Murine) (26), Rat (Rattus) (25), Pig (Porcine) (3), Cow (Bovine) (2), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (42), Immunofluorescence (IF) (22), ELISA (21), Immunohistochemistry (IHC) (10), Flow Cytometry (FACS) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Biotin (5), FITC (2), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (8), AA 30-46 (2), Internal Region (2), AA 278-293 (1), AA 3-3 (1), AA 33-310 (1), Center (1), N-Term (1)