Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182567

Neurogenic Differentiation 6 (NEUROD6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nex1, Xath2, atoh2, math2, nex1m, bhlha2, math-2, neurod6-A, RGD1562793, Atoh2, MATH2, Math-2, NEX1M, Nex1, bHLHa2, Math2, Nex, Nex1m, MGC145341
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182567
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NEUROD6 antibody: synthetic peptide directed towards the N terminal of human NEUROD6
Sequence MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEET EKEEEEEDRE
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Horse : 92%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against NEUROD6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NEUROD6
Background NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Molecular Weight 39kDa
Gene ID 63974
NCBI Accession NP_073565, NM_022728
UniProt Q96NK8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NEUROD6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Neurogenic Differentiation 6 (NEUROD6)", type "Antibodies"
Hosts (23), (3)
Reactivities (25), (17), (15), (15), (3), (3), (2), (2)
Applications (16), (10), (8), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (1), (1), (1)
Beacon