Neurogenic Differentiation 6 (NEUROD6) (N-Term) antibody

Details for Product No. ABIN182567
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nex1, Xath2, atoh2, math2, nex1m, bhlha2, math-2, neurod6-A, RGD1562793, Atoh2, MATH2, Math-2, NEX1M, Nex1, bHLHa2, Math2, Nex, Nex1m, MGC145341
Epitope
N-Term
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(27), (17), (15), (15), (3), (3), (2), (2)
Host
Rabbit
(22), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (11), (10), (6), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN182567
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NEUROD6
Sequence MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEET EKEEEEEDRE
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Horse : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against NEUROD6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NEUROD6
Background NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Molecular Weight 39 kDa
Gene ID 63974
NCBI Accession NM_022728, NP_073565
UniProt Q96NK8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 337 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology...." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Hosts (22), (6)
Reactivities (27), (17), (15), (15), (3), (3), (2), (2)
Applications (18), (11), (10), (6), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top