Heat Shock Transcription Factor 4 (HSF4) antibody

Antigen: Heat Shock Transcription Factor 4 (HSF4)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN182633

Additional Information

Alternative name: Heat shock factor 4 / HSF4

Gene ID: HSF4

UniProt: Q9ULV5-2

Immunogen: The immunogen for anti-HSF4 antibody: synthetic peptide directed towards the middle region of human HSF4

Sequence: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSL MLDEGSSCPT

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-HSF4 antibody concentration is 1 mg/ml.

Description: Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.

Characteristics: Antigen Size: 463 amino acids

Molecular Weight: 50kDa

Application Details

Application Notes: WB Suggested Anti-HSF4 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HSF4 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).