Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182655

Forkhead Box P3 (FOXP3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms sf, JM2, scurfin, AIID, DIETER, IPEX, PIDX, XPID, RGD1562112, foxp3, FOXP3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182655
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3
Sequence PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATG VFSLKARPGL
Predicted Reactivity Bovine : 100%, Human : 100%, Pig : 100%, Sheep : 100%, Horse : 92%, Mouse : 92%, Rat : 85%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against FOXP3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name FOXP3
Background Forkhead box protein P3 (FOXP3, Scurfin, Zinc finger protein JM2) encodes a novel member of the forkhead family of transcription factors. It presumably represses transcription, playing a paramount role in determining the amplitude of the response of CD4 T cells to activation
Molecular Weight 47kDa
Gene ID 50943
NCBI Accession NP_054728, NM_014009
UniProt Q9BZS1
Research Area Immunology, Adaptive Immunity, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Takahata, Nomura, Takada et al.: "CD25+CD4+ T cells in human cord blood: an immunoregulatory subset with naive phenotype and specific expression of forkhead box p3 (Foxp3) gene." in: Experimental hematology, Vol. 32, Issue 7, pp. 622-9, 2004 (PubMed).

Alternatives for antigen "Forkhead Box P3 (FOXP3)", type "Antibodies"
Hosts (146), (62), (43), (16)
Reactivities (187), (148), (61), (15), (15), (14), (12), (8), (1), (1)
Applications (172), (95), (60), (44), (44), (20), (11), (10), (10), (7), (7), (6), (3), (3), (3)
Conjugates (19), (13), (12), (9), (6), (6), (4), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (53), (13), (7), (7), (7), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon