Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6) antibody

Antigen

Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6)

Synonyms EAR2, EAR-2, ERBAL2, Erbal2, AV090102, COUP-TF3, NR2F6, fc94g11, zgc:77259, wu:fc94g11, nr2f6, MGC69000, ear2, ear-2, erbal2, MGC69386
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182722
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name NR2F6
Gene ID NR2F6
UniProt P10588
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the middle region of human NR2F6
Sequence GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYG CLKAIALFTP
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-NR2F6 antibody concentration is 1 mg/ml.
Description NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Characteristics Antigen Size: 404 amino acids
Molecular Weight 43kDa

Application Details

Application Notes WB Suggested Anti-NR2F6 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives

Alternatives for antigen "Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6)", type "Antibodies"
Hosts Rabbit (21), Mouse (8), Goat (3)
Reactivities Human (29), Rat (Rattus) (10), Mouse (Murine) (5), Cow (Bovine) (4), Pig (Porcine) (4), Rabbit (4), Dog (Canine) (3), Monkey (1), Xenopus laevis (1)
Applications Western Blotting (WB) (25), ELISA (16), Immunofluorescence (IF) (7), Immunohistochemistry (IHC) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunoprecipitation (IP) (4), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Epitopes N-Term (7), AA 20-70 (2), C-Term (1), Internal Region (1), Ligand Binding Domain (1), N-Term,AA 24-53 (1)