Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182739

phosphorylase Kinase, gamma 2 (Testis) (PHKG2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GSD9C, 1500017I02Rik, zgc:55863, PHKG2, MGC145608
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Pig (Porcine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182739
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHKG2 antibody: synthetic peptide directed towards the N terminal of human PHKG2
Sequence EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATG HEFAVKIMEV
Predicted Reactivity Bovine : 100%, Dog : 100%, Goat : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Sheep : 100%, Mouse : 92%, Rat : 92%, Zebrafish : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against PHKG2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PHKG2
Background Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.
Molecular Weight 46kDa
Gene ID 5261
NCBI Accession NP_000285, NM_000294
UniProt P15735
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHKG2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Burwinkel, Shiomi, Al Zaben et al.: "Liver glycogenosis due to phosphorylase kinase deficiency: PHKG2 gene structure and mutations associated with cirrhosis." in: Human molecular genetics, Vol. 7, Issue 1, pp. 149-54, 1998 (PubMed).

Alternatives for antigen "phosphorylase Kinase, gamma 2 (Testis) (PHKG2)", type "Antibodies"
Hosts (28), (11)
Reactivities (38), (21), (14), (12), (12), (12)
Applications (27), (17), (10), (8), (8), (3), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (8), (2), (2), (2), (1), (1)
Beacon