PHKG2 antibody

Catalog No. ABIN631242

The Rabbit Polyclonal anti-PHKG2 antibody (ABIN631242) specifically detects PHKG2 in WB and IHC. The antibody is reactive with Human and Dog samples.

Quick Overview for PHKG2 antibody (ABIN631242)

Target: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHKG2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-PHKG2 Antibody

Purification: Affinity purified

Immunogen: PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHKG2 Blocking Peptide, (ABIN937695), is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHKG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHKG2

Target: PHKG2 (phosphorylase Kinase, gamma 2 (Testis) (PHKG2))

Alternative Name: PHKG2

Background: Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process