Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cyclin L1 (CCNL1) antibody

Antigen

Cyclin L1 (CCNL1)
Synonyms BM-001, PRO1073, ania-6a, Ccnl, AU018493, 2610030E23Rik, Ania-6a, MGC93069, fd99b09, zgc:55544, wu:fd99b09, MCM2, CCNL1, MGC132032, bm-001, pro1073, MGC108436, Ccnl1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN182754
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Cyclin L1 (CCNL1) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name Cyclin L1
Gene ID CCNL1
UniProt Q8NI48
Immunogen The immunogen for anti-CCNL1 antibody: synthetic peptide directed towards the N terminal of human CCNL1
Sequence TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQ DGLDLPSETD
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-CCNL1 antibody concentration is 1 mg/ml.
Description CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
Characteristics Antigen Size: 526 amino acids
Molecular Weight 60kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-CCNL1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Cyclin L1 (CCNL1)", type "Antibodies"
Hosts Rabbit (38), Mouse (1)
Reactivities Human (37), Rat (Rattus) (24), Mouse (Murine) (22), Dog (Canine) (19), Chicken (18), Chimpanzee (18), Cat (Feline) (1), Cow (Bovine) (1)
Applications Western Blotting (WB) (24), ELISA (20), Immunofluorescence (IF) (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Immunoprecipitation (IP) (7), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (4), N-Term (3), AA 314-369 (2), Isoform 1 (1)