Zinc Finger and SCAN Domain Containing 18 (ZSCAN18) antibody

Antigen: Zinc Finger and SCAN Domain Containing 18 (ZSCAN18)

Synonyms: EG232875, RGD1560671

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182774

Additional Information

Alternative name: ZSCAN18

Gene ID: ZNF447

UniProt: Q8TBC5

Immunogen: The immunogen for anti-ZNF447 antibody: synthetic peptide directed towards the N terminal of human ZNF447

Sequence: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPE ARSKEQMLEL

Cross-Reactivity: Dog (Canine), Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF447 antibody concentration is 1 mg/ml.

Description: ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 510 amino acids

Molecular Weight: 55kDa

Application Details

Application Notes: WB Suggested Anti-ZNF447 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF447 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).