Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182814

Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DP2, DP3, DP-3, 1110029I05Rik, A330080J22Rik, Tcfdp2, dp2, dp-2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182814
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TFDP2 antibody: synthetic peptide directed towards the N terminal of human TFDP2
Sequence MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWV PGDRKRARKF
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Dog : 92%, Rat : 85%, Chicken : 78%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against TFDP2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name TFDP2
Background The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation.
Molecular Weight 43kDa
Gene ID 7029
NCBI Accession NP_006277, NM_006286
UniProt Q14188-4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TFDP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Korz, Pscherer, Benner et al.: "Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes." in: Blood, Vol. 99, Issue 12, pp. 4554-61, 2002 (PubMed).

Alternatives for antigen "Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2)", type "Antibodies"
Hosts (24), (9)
Reactivities (30), (18), (18), (12), (12), (12), (11), (1)
Applications (20), (9), (7), (3), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1)
Beacon