Did you know that you can buy products from over 140 different suppliers from us?

Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody

Details for Product No. ABIN182814
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms dp2, dp-2, 1110029I05Rik, A330080J22Rik, DP-3, DP3, DP2, Tcfdp2
Epitope
N-Term
(4), (4), (3), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(33), (20), (20), (11), (11), (11), (11), (1)
Host
Rabbit
(29), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(24), (9), (9), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182814
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TFDP2
Sequence MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWV PGDRKRARKF
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Dog : 90 %, Rat : 80 %, Chicken : 70 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against TFDP2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name TFDP2
Background The TFDP genes encode a family of transcription factors that can form heterodimers with E2F family proteins in vivo. The E2F-TFDP transcription factors are major regulators of genes that are required for the progression of S-phase, such as DHFR and DNA polymerase alpha, and they play a critical role in cell cycle regulation and differentiation.
Molecular Weight 43 kDa
Gene ID 7029
NCBI Accession NM_006286, NP_006277
UniProt Q14188-4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 386 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody WB Suggested Anti-TFDP2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody (2) anti-Transcription Factor Dp-2 (E2F Dimerization Partner 2) (TFDP2) (N-Term) antibody (Image 2)
Background publications Korz, Pscherer, Benner et al.: "Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes." in: Blood, Vol. 99, Issue 12, pp. 4554-61, 2002 (PubMed).

Validation Images
back to top