Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1) antibody

Antigen: Wolf-Hirschhorn Syndrome Candidate 1 (WHSC1)

Synonyms: WHS, NSD2, TRX5, MMSET, REIIBP, FLJ23286, KIAA1090, MGC176638, Whsc1l, AW555663, mKIAA1090, 5830445G22Rik, 9430010A17Rik, C130020C13Rik, D030027O06Rik, D930023B08Rik, WHSC1, RGD1565590, fc12c04, wu:fc12c04, wu:fi20c01, si:rp71-77d7.2, whs, nsd2, trx5, mmset, reiibp

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182817

Additional Information

Alternative name: WHSC1

Gene ID: WHSC1

UniProt: O96031

Immunogen: The immunogen for anti-WHSC1 antibody: synthetic peptide directed towards the N terminal of human WHSC1

Sequence: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKS ARQYHVQFFG

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-WHSC1 antibody concentration is 1 mg/ml.

Description: WHSC1 encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4.

Characteristics: Antigen Size: 802 amino acids

Molecular Weight: 88kDa

Synonyms: WHS, NSD2, TRX5, MMSET, REIIBP, FLJ23286, KIAA1090, MGC176638, Whsc1l, AW555663, mKIAA1090, 5830445G22Rik, 9430010A17Rik, C130020C13Rik, D030027O06Rik, D930023B08Rik, WHSC1, RGD1565590, fc12c04, wu:fc12c04, wu:fi20c01, si:rp71-77d7.2, whs, nsd2, trx5, mmset, reiibp

Application Details

Application Notes: WB Suggested Anti-WHSC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-WHSC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Santra, Zhan, Tian et al.: "A subset of multiple myeloma harboring the t(4;14)(p16;q32) translocation lacks FGFR3 expression but maintains an IGH/MMSET fusion transcript." in: Blood, Vol. 101, Issue 6, pp. 2374-6, 2003 (PubMed).