Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182859

Zinc Finger Protein 436 (ZNF436) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF, Zfp46, AI426962, Mlz-4, Zfp-46, Znf436, PRDM9, ZNF436, DKFZp459C0527
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182859
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF436 antibody: synthetic peptide directed towards the N terminal of human ZNF436
Sequence RQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHC GKAFSQISDL
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Pig : 92%, Guinea pig : 91%
Characteristics This is a rabbit polyclonal antibody against ZNF436. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF436
Background ZNF436 is a candidate transcription factor
Molecular Weight 54kDa
Gene ID 80818
NCBI Accession NP_085137, NM_030634
UniProt Q9C0F3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF436 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lichter, Bray, Ried et al.: "Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes." in: Genomics, Vol. 13, Issue 4, pp. 999-1007, 1992 (PubMed).

Alternatives for antigen "Zinc Finger Protein 436 (ZNF436)", type "Antibodies"
Hosts (14), (2)
Reactivities (16), (1), (1), (1), (1)
Applications (14), (5), (2), (2), (2)
Epitopes (5), (2), (2), (1), (1)
Beacon