Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2) antibody

Antigen: Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182886

Additional Information

Alternative name: SLC17A2 / NPT3

Gene ID: SLC17A2

Immunogen: The immunogen for anti-SLC17A2 antibody: synthetic peptide directed towards the middle region of human SLC17A2

Sequence: VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAM VTCLPLWAIF

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SLC17A2 antibody concentration is 1 mg/ml.

Description: SLC17A2 is a member of the solute carrier family.

Characteristics: Antigen Size: 436 amino acids

Molecular Weight: 48kDa

Application Details

Application Notes: WB Suggested Anti-SLC17A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC17A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

anti-Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2) antibody (Image 2)

Publications

Product: Ruddy, Kronmal, Lee et al.: "A 1.1-Mb transcript map of the hereditary hemochromatosis locus." in: Genome research, Vol. 7, Issue 5, pp. 441-56, 1997 (PubMed).