SLC17A2 antibody

Catalog No. ABIN635573

The Rabbit Polyclonal anti-SLC17A2 antibody is suitable to detect SLC17A2 in samples from Human. It has been validated for WB and IHC.

Quick Overview for SLC17A2 antibody (ABIN635573)

Target: SLC17A2 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC17A2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC17A2 Antibody

Purification: Affinity purified

Immunogen: SLC17 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC17A2 Blocking Peptide, (ABIN5616185), is also available for use as a blocking control in assays to test for specificity of this SLC17A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC17A2

Target: SLC17A2 (Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2))

Alternative Name: SLC17A2

Background: SLC17A2 is a member of the solute carrier family.

Molecular Weight: 48 kDa (MW of target protein)