Kinesin Family Member 25 (KIF25) antibody

Antigen: Kinesin Family Member 25 (KIF25)

Synonyms: KNSL3, MGC163361

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182907

Additional Information

Alternative name: KIF25

Gene ID: KIF25

UniProt: Q9UIL4

Immunogen: The immunogen for anti-KIF25 antibody: synthetic peptide directed towards the C terminal of human KIF25

Sequence: VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCIS PSQRHLAQTL

Cross-Reactivity: Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-KIF25 antibody concentration is 1 mg/ml.

Description: The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular function of this gene product has not yet been determined. Two alternatively spliced transcript variants which encode products have been described. Other splice variants have been found that lack exon 2 and the initiation codon for translation.

Characteristics: Antigen Size: 384 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Cytoskeleton

Restrictions: For Research Use only

Images

WB Suggested Anti-KIF25 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

anti-Kinesin Family Member 25 (KIF25) antibody (Image 2)

Publications

Product: Miki, Setou, Kaneshiro et al.: "All kinesin superfamily protein, KIF, genes in mouse and human." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 98, Issue 13, pp. 7004-11, 2001 (PubMed).