Did you know that you can buy products from over 140 different suppliers from us?

FLJ37300 (FLJ37300) (N-Term) antibody

Details for Product No. ABIN182923
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182923
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ37300
Sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGI TEVSTINAKE
Predicted Reactivity Bovine :100 %,   Human :100 % Mouse :90 %,   Western clawed frog :90 %,   Rat :90 %,   African clawed frog :90 %,   Red flour beetle :90 %,   Starlet sea anemone :80 %,   Zebrafish :70 %,   Green puffer :70 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ37300. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ37300
Background FLJ37300 is a hypothetical protein found on chromosome 17.
Molecular Weight 62 kDa
Gene ID 124602
NCBI Accession NM_153209, NP_694941
UniProt Q8N1X8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 548 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ37300 (FLJ37300) (N-Term) antibody WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml
Positive Control: Jurkat cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182923
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top