Did you know that you can buy products from over 140 different suppliers from us?

FLJ37300 (FLJ37300) (N-Term) antibody

Details for Product No. ABIN182923
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182923
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ37300
Sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGI TEVSTINAKE
Predicted Reactivity Bovine :100 %,   Human :100 % Mouse :90 %,   Western clawed frog :90 %,   Rat :90 %,   African clawed frog :90 %,   Red flour beetle :90 %,   Starlet sea anemone :80 %,   Zebrafish :70 %,   Green puffer :70 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ37300. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ37300
Background FLJ37300 is a hypothetical protein found on chromosome 17.
Molecular Weight 62 kDa
Gene ID 124602
NCBI Accession NM_153209, NP_694941
UniProt Q8N1X8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 548 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ37300 (FLJ37300) (N-Term) antibody WB Suggested Anti-FLJ37300 Antibody Titration: 0.125ug/ml
Positive Control: Jurkat cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (1)
Applications (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182923
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top