Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ubiquitin-Conjugating Enzyme E2N (UBE2N) antibody

Antigen

Ubiquitin-Conjugating Enzyme E2N (UBE2N)

Synonyms UBC13, AL022654, BB101821, 1500026J17Rik, MGC93937, ube2n, MGC64428, zgc:55726, wu:fb11b03, wu:fc08b06, UBE2N, MGC139855, ubc13, MGC75672, ubch-ben
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Zebrafish, Chicken, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182924
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name UBE2N / BLU
Gene ID UBE2N
UniProt P61088
Immunogen The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N
Sequence VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD PLANDVAEQW
Cross-Reactivity Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-UBE2N antibody concentration is 1 mg/ml.
Description UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
Characteristics Antigen Size: 152 amino acids
Molecular Weight 17kDa

Application Details

Application Notes WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Bothos, Summers, Venere et al.: "The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains." in: Oncogene, Vol. 22, Issue 46, pp. 7101-7, 2003 (PubMed).

Alternatives

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2N (UBE2N)", type "Antibodies"
Hosts Rabbit (45), Goat (4), Mouse (2)
Reactivities Human (44), Mouse (Murine) (24), Rat (Rattus) (24), Cow (Bovine) (20), Dog (Canine) (19), Chicken (18), Horse (Equine) (18), Rabbit (18), Fruit Fly (Drosophila melanogaster) (1), Zebrafish (1)
Applications Western Blotting (WB) (35), ELISA (20), Immunofluorescence (IF) (18), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (12), Immunohistochemistry (IHC) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes C-Term (6), N-Term (4), AA 40-51 (3), Internal Region (2), AA 2-19 (1)