Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tryptophan Hydroxylase 2 (TPH2) antibody

Antigen

Tryptophan Hydroxylase 2 (TPH2)

Synonyms TPH2, NTPH, ADHD7, FLJ37295, MGC138871, MGC138872, Ntph, tph2, tph1l, tphD2, tphR, wu:fq15a04
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN182938
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Tryptophan 5-hydroxylase 2 (TPH2)
Gene ID TPH2
UniProt Q8IWU9
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2
Sequence REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHI ESRKSRRRSS
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TPH2 antibody concentration is 1 mg/ml.
Description Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
Characteristics Antigen Size: 490 amino acids
Molecular Weight 56kDa

Application Details

Application Notes WB Suggested Anti-TPH2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Walther, Peter, Bashammakh et al.: "Synthesis of serotonin by a second tryptophan hydroxylase isoform." in: Science (New York, N.Y.), Vol. 299, Issue 5603, pp. 76, 2003 (PubMed).

Alternatives

Alternatives for antigen "Tryptophan Hydroxylase 2 (TPH2)", type "Antibodies"
Hosts Rabbit (38), Goat (9)
Reactivities Human (36), Rat (Rattus) (30), Mouse (Murine) (29), Cow (Bovine) (22), Horse (Equine) (18), Dog (Canine) (3), Zebrafish (Danio rerio) (2), Chicken (1), Pig (Porcine) (1), Zebrafish (1)
Applications Western Blotting (WB) (25), ELISA (17), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Flow Cytometry (FACS) (2), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes AA 208-245 (18), N-Term (7), Internal Region (4), pSer19 (4), AA 16-29 (2), Center (2), Internal Region,AA 173-203 (1), N-Term,AA 16-29 (1)