Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182983

MANSC Domain Containing 1 (MANSC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9130403P13Rik, LOH12CR3, MANSC1, DKFZp469A172
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN182983
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MANSC1 antibody: synthetic peptide directed towards the N terminal of human MANSC1
Sequence LTLRLSASQNCLKKSLEDVVIDIQSSLSKGIRGNEPVYTS TQEDCINSCC
Predicted Reactivity Human : 100%, Horse : 91%, Bovine : 83%
Characteristics This is a rabbit polyclonal antibody against MANSC1. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name MANSC1
Background MANSC1, located on chromosome 12, encodes a protein whose function is not yet defined.
Molecular Weight 47kDa
Gene ID 54682
NCBI Accession NP_060520, NM_018050
UniProt Q9H8J5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MANSC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "MANSC Domain Containing 1 (MANSC1)", type "Antibodies"
Hosts (6)
Reactivities (6), (2)
Applications (6), (3), (1)
Epitopes (4), (2), (2)
Beacon