Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183005

ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Apg4b, APG4B, Aut2b2, apg4b, AUTL1, Autl1, Atg4bl, AW048066, 2510009N07Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183005
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-APG4B antibody: synthetic peptide directed towards the C terminal of human APG4B
Sequence LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFF DSEDEDFEIL
Predicted Reactivity Pig :100%,   Human :100%,   Rat :100%,   Mouse :100%,   Tunicate :100%,   Bovine :92%,   Chicken :85%,   Zebrafish :84%,   Atlantic salmon :84%,   Western clawed frog :78%,   African clawed frog :78%,  
Characteristics This is a rabbit polyclonal antibody against APG4B. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name APG4B
Background Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. APG4B encodes a member of the autophagin protein family and is also designated as a member of the C-54 family of cysteine proteases.
Molecular Weight 44kDa
Gene ID 23192
NCBI Accession NP_037457, NM_013325
UniProt Q9Y4P1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-APG4B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Tanida, Sou, Ezaki et al.: "HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates." in: The Journal of biological chemistry, Vol. 279, Issue 35, pp. 36268-76, 2004 (PubMed).

Alternatives for antigen "ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B)", type "Antibodies"
Hosts (68), (3), (2)
Reactivities (73), (31), (19), (17), (14), (13), (4), (3), (2), (1), (1), (1)
Applications (52), (20), (19), (18), (17), (3), (2), (2)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (9), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Beacon