Did you know that you can buy products from over 140 different suppliers from us?

ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody

Details for Product No. ABIN183005
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Apg4b, APG4B, Aut2b2, apg4b, AUTL1, Autl1, Atg4bl, AW048066, 2510009N07Rik
Epitope
C-Term
(14), (12), (9), (8), (7), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(89), (33), (18), (15), (13), (13), (2), (2), (2), (1), (1)
Host
Rabbit
(86), (3), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(68), (32), (29), (20), (16), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183005
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human APG4B
Sequence LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFF DSEDEDFEIL
Predicted Reactivity Pig :100 %,   Human :100 %,   Rat :100 %,   Mouse :100 %,   Tunicate :100 %,   Bovine :90 %,   Chicken :80 %,   Zebrafish :80 %,   Atlantic salmon :80 %,   Western clawed frog :70 %,   African clawed frog :70 %,  
Characteristics This is a rabbit polyclonal antibody against APG4B. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name APG4B
Background Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. APG4B encodes a member of the autophagin protein family and is also designated as a member of the C-54 family of cysteine proteases.
Molecular Weight 44 kDa
Gene ID 23192
NCBI Accession NM_013325, NP_037457
UniProt Q9Y4P1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 393 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody WB Suggested Anti-APG4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Raji cell lysate
anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody (2) anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) (C-Term) antibody (Image 2)
Background publications Tanida, Sou, Ezaki et al.: "HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates." in: The Journal of biological chemistry, Vol. 279, Issue 35, pp. 36268-76, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183005
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top