Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) antibody

Antigen

ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B)
Synonyms Apg4b, MGC112887, ATG4B, APG4B, Aut2b2, apg4b, Atg4b, AUTL1, MGC1353
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Chicken, Zebrafish, Xenopus laevis
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN183005
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) antibody

anti-ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B) antibody (2)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name APG4B / ATG4B
Gene ID APG4B
UniProt Q9Y4P1
Immunogen The immunogen for anti-APG4B antibody: synthetic peptide directed towards the C terminal of human APG4B
Sequence LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFF DSEDEDFEIL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-APG4B antibody concentration is 1 mg/ml.
Description Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. APG4B encodes a member of the autophagin protein family and is also designated as a member of the C-54 family of cysteine proteases.
Characteristics Antigen Size: 393 amino acids
Molecular Weight 44kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-APG4B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Raji cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Tanida, Sou, Ezaki et al.: "HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates." in: The Journal of biological chemistry, Vol. 279, Issue 35, pp. 36268-76, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "ATG4 Autophagy Related 4 Homolog B (S. Cerevisiae) (ATG4B)", type "Antibodies"
Hosts Rabbit (62), Mouse (1), Sheep (1)
Reactivities Human (63), Mouse (Murine) (30), Rat (Rattus) (23), Cow (Bovine) (21), Dog (Canine) (20), Chicken (9), Cat (Feline) (1), Pig (Porcine) (1), Xenopus laevis (1), Zebrafish (Danio rerio) (1)
Applications Western Blotting (WB) (41), ELISA (31), Immunofluorescence (IF) (21), Immunohistochemistry (IHC) (16), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (16), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes N-Term (5), pSer309 (5), C-Term (3), AA 350-400 (1), Internal Region (1), pSer121 (1), pSer261 (1)