TRIM17 / RNF16 (TRIM17) (C-Term) antibody

Details for Product No. ABIN183029
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RBCC, terf, RNF16, Rnf16, TRIM17
Epitope
C-Term
(4), (1), (1), (1), (1)
Reactivity
Human
(25), (15), (15), (1)
Host
Rabbit
(32), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(20), (19), (12), (7), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183029
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TRIM17
Sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGI FLDFEAGEVS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TRIM17. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIM17
Background TRIM17 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein is expressed almost exclusively in the testis, but its function is unknown. Multiple alternatively spliced transcript variants have been found for this gene.
Molecular Weight 54 kDa
Gene ID 51127
NCBI Accession NM_001024940, NP_001020111
UniProt Q9Y577
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 477 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TRIM17 / RNF16 (TRIM17) (C-Term) antibody WB Suggested Anti-TRIM17 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Hosts (32), (5)
Reactivities (25), (15), (15), (1)
Applications (20), (19), (12), (7), (2), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (4), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top