CAMP Responsive Element Binding Protein 3-Like 2 (CREB3L2) antibody
| Antigen | CAMP Responsive Element Binding Protein 3-Like 2 (CREB3L2) |
| Synonyms | BBF2H7, MGC71006, MGC131709, C530025K05Rik, Ra69, CREB3L2, MGC179367, DKFZp469F144, bbf2h7 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine) |
| Application |
Alternatives Western Blotting (WB), Immunohistochemistry (IHC) |
 |
1 reference available |
| Catalog no. | ABIN183063 |
| Quantity | 0.1 mg |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | CREB3L2 |
| Gene ID | CREB3L2 |
| UniProt | Q70SY1 |
| Immunogen | The immunogen for anti-CREB3L2 antibody: synthetic peptide directed towards the N terminal of human CREB3L2 |
| Sequence | TSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVE SEKWYLSTDF |
| Cross-Reactivity | Cow (Bovine), Human, Mouse (Murine) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-CREB3L2 antibody concentration is 1 mg/ml. |
| Description | CREB3L2 is a member of the old astrocyte specifically induced substance (OASIS) DNA binding and basic leucine zipper dimerization (bZIP) family of transcription factors, which includes CREB3 (MIM 606443) and CREB4 (MIM 607138). |
| Characteristics | Antigen Size: 520 amino acids |
| Molecular Weight | 57kDa |
Application Details
| Application Notes |
WB Suggested Anti-CREB3L2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-CREB3L2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate anti-CAMP Responsive Element Binding Protein 3-Like 2 (CREB3L2) antibody (Image 2) |
Publications
| Product |
Storlazzi, Mertens, Nascimento et al.: "Fusion of the FUS and BBF2H7 genes in low grade fibromyxoid sarcoma." in: Human molecular genetics, Vol. 12, Issue 18, pp. 2349-58, 2003 (PubMed).
|
Alternatives
Alternatives for antigen "CAMP Responsive Element Binding Protein 3-Like 2 (CREB3L2)", type "Antibodies"
| Hosts | Rabbit (8) |
| Reactivities | Human (8), Mouse (Murine) (4), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1) |
| Applications | Western Blotting (WB) (8), ELISA (7), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1) |
| Epitopes | C-Term (2), N-Term (1) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
