Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183077

BTB (POZ) Domain Containing 3 (BTBD3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms dJ742J24.1, mKIAA0952, btbd3, si:dkey-210m15.6, BTBD3, DKFZp459C1423
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183077
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BTBD3 antibody: synthetic peptide directed towards the middle region of human BTBD3
Sequence FLWYTAAKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQW RYRGRCDSIQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 78%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against BTBD3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name BTBD3
Background BTBD3 is a protein containing BTB/POZ domain. Its function has not been determined yet.
Molecular Weight 58kDa
Gene ID 22903
NCBI Accession NP_055777, NM_014962
UniProt Q9Y2F9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BTBD3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "BTB (POZ) Domain Containing 3 (BTBD3)", type "Antibodies"
Hosts (19), (2)
Reactivities (20), (16), (14), (14), (13), (12), (12), (2), (1), (1)
Applications (12), (10), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1)
Beacon