Zinc Finger Protein 627 (ZNF627) antibody

Antigen: Zinc Finger Protein 627 (ZNF627)

Synonyms: FLJ90365, ZNF627

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN183092

Additional Information

Alternative name: ZNF627

Gene ID: ZNF627

UniProt: Q7L945

Immunogen: The immunogen for anti-ZNF627 antibody: synthetic peptide directed towards the N terminal of human ZNF627

Sequence: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETF SQIPDGILNK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF627 antibody concentration is 1 mg/ml.

Description: Located on chromosome 19, this gene encodes for zinc finger protein 627.

Characteristics: Antigen Size: 461 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-ZNF627 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF627 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).