Voltage-Dependent Anion Channel 1 (VDAC1) (C-Term) antibody

Details for Product No. ABIN183134
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PORIN, VDAC-1, Vdac5, AL033343, fa13f11, zgc:85830, wu:fa13f11, 5076, ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 1, ATVDAC1, T22N4.9, T22N4_9, voltage dependent anion channel 1, vdac1, VDAC1
Epitope
C-Term
(36), (7), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish (Danio rerio), Human, Horse (Equine), Sheep (Ovine)
(83), (35), (33), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(46), (43)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(87), (49), (38), (26), (14), (4), (2), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183134
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human VDAC1
Sequence SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGH KLGLGLEFQA
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, African clawed frog : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against VDAC1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name VDAC1
Background The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Molecular Weight 31 kDa
Gene ID 7416
NCBI Accession NM_003374, NP_003365
UniProt Q5FVE7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 283 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (C-Term) antibody WB Suggested Anti-VDAC1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Voltage-Dependent Anion Channel 1 (VDAC1) (C-Term) antibody (2) anti-Voltage-Dependent Anion Channel 1 (VDAC1) (C-Term) antibody (Image 2)
Background publications Zheng, Shi, Tian et al.: "Essential role of the voltage-dependent anion channel (VDAC) in mitochondrial permeability transition pore opening and cytochrome c release induced by arsenic trioxide." in: Oncogene, Vol. 23, Issue 6, pp. 1239-47, 2004 (PubMed).

Hosts (46), (43)
Reactivities (83), (35), (33), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1)
Applications (87), (49), (38), (26), (14), (4), (2), (2), (1), (1), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1)
Epitopes (36), (7), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top