Did you know that you can buy products from over 140 different suppliers from us?

Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibody

Details for Product No. ABIN183138
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACCN3, DRASIC, SLNAC1, TNaC1, AW742291, Accn3, TNAC1
Epitope
N-Term
(10), (9), (4), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(31), (29), (21), (17)
Host
Rabbit
(37), (4), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (15), (14), (12), (8), (3), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183138
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACCN3
Sequence VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLC NINPLRRSRL
Predicted Reactivity Human : 100 %, Mouse : 80 %, Rabbit : 80 %, Rat : 80 %, Bovine : 80 %, Dog : 80 %, Guinea pig : 80 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against ACCN3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ACCN3
Background ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
Molecular Weight 58 kDa
Gene ID 9311
NCBI Accession NM_004769, NP_004760
UniProt Q9UHC3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 531 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibody anti-Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibody
Background publications Jones, Slater, Cadiou et al.: "Acid-induced pain and its modulation in humans." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 24, Issue 48, pp. 10974-9, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183138
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top