Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183138

Amiloride-Sensitive Cation Channel 3 (ACCN3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACCN3, DRASIC, SLNAC1, TNaC1, AW742291, Accn3, TNAC1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183138
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ACCN3 antibody: synthetic peptide directed towards the N terminal of human ACCN3
Sequence VATFLYQVAERVRYYREFHHQTALDERESHRLIFPAVTLC NINPLRRSRL
Predicted Reactivity Human : 100%, Mouse : 86%, Rabbit : 86%, Rat : 86%, Bovine : 80%, Dog : 80%, Guinea pig : 80%, Horse : 80%
Characteristics This is a rabbit polyclonal antibody against ACCN3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name ACCN3
Background ACCN3 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, two hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. ACCN3 encodes a member that is an acid sensor and may play an important role in the detection of lasting pH changes. In addition, a heteromeric association between this member and ACCN1 has been observed as proton-gated channels sensitive to gadolinium.
Molecular Weight 58kDa
Gene ID 9311
NCBI Accession NP_004760, NM_004769
UniProt Q9UHC3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ACCN3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jones, Slater, Cadiou et al.: "Acid-induced pain and its modulation in humans." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 24, Issue 48, pp. 10974-9, 2004 (PubMed).

Alternatives for antigen "Amiloride-Sensitive Cation Channel 3 (ACCN3)", type "Antibodies"
Hosts (30), (5), (1)
Reactivities (28), (23), (20), (17)
Applications (17), (15), (10), (9), (6), (5), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (3), (2), (1), (1)
Beacon