Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Thyroid Hormone Receptor Interactor 13 (TRIP13) antibody

Antigen

Thyroid Hormone Receptor Interactor 13 (TRIP13)

Synonyms 16E1BP, D13Ertd328e, 2410002G23Rik, MGC65952, zgc:65952, trip13, MGC76197, TRIP13
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183210
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TRIP13
Gene ID TRIP13
UniProt Q15645
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the N terminal of human TRIP13
Sequence KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAA NHWVLPAAEF
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-TRIP13 antibody concentration is 1 mg/ml.
Description The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
Characteristics Antigen Size: 432 amino acids
Molecular Weight 49kDa

Application Details

Application Notes WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "Thyroid Hormone Receptor Interactor 13 (TRIP13)", type "Antibodies"
Hosts Rabbit (34), Mouse (4)
Reactivities Human (37), Mouse (Murine) (22), Rat (Rattus) (22), Chicken (19), Dog (Canine) (19), Cow (Bovine) (18), Horse (Equine) (18), Rabbit (18), Pig (Porcine) (1)
Applications Western Blotting (WB) (22), Immunofluorescence (IF) (15), ELISA (14), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (Dot) (1), Immunoassay (IA) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes N-Term (5), C-Term (4)