Zinc Finger Protein 660 (ZNF660) (C-Term) antibody

Details for Product No. ABIN183320
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
C-Term
(4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(10), (3), (1), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(10), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183320
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF660
Sequence TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQ RKHNEEKETS
Predicted Reactivity Dog : 92 %
Characteristics This is a rabbit polyclonal antibody against ZNF660. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ZNF660
Background Located on chromosome 3, the ZNF660 gene encodes for zinc finger protein 660.
Molecular Weight 38 kDa
Gene ID 285349
NCBI Accession NM_173658, NP_775929
UniProt Q6AZW8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 331 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody WB Suggested Anti-ZNF660 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody (2) anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody (Image 2)
Product cited in: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (10)
Reactivities (10), (3), (1), (1)
Applications (10), (2), (1)
Epitopes (4), (2), (1)
back to top