Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 660 (ZNF660) (C-Term) antibody

Details for Product No. ABIN183320
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
(8), (7), (4)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(16), (3), (1), (1)
Host
Rabbit
(16)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (6), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183320
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF660
Sequence TFRQTSQVILHLRTHTKEKPYKCSECGKAYRYSSQLIQHQ RKHNEEKETS
Predicted Reactivity Dog : 92 %
Characteristics This is a rabbit polyclonal antibody against ZNF660. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name ZNF660
Background Located on chromosome 3, the ZNF660 gene encodes for zinc finger protein 660.
Molecular Weight 38 kDa
Gene ID 285349
NCBI Accession NM_173658, NP_775929
UniProt Q6AZW8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 331 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody WB Suggested Anti-ZNF660 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody (2) anti-Zinc Finger Protein 660 (ZNF660) (C-Term) antibody (Image 2)
Product cited in: Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183320
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top