Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PiggyBac Transposable Element Derived 3 (PGBD3) antibody

Antigen

PiggyBac Transposable Element Derived 3 (PGBD3)

Synonyms FLJ90201, ERCC6
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183354
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name PGBD3
Gene ID PGBD3
UniProt Q8N328
Immunogen The immunogen for anti-PGBD3 antibody: synthetic peptide directed towards the N terminal of human PGBD3
Sequence NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVP STFTVQQPPP
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-PGBD3 antibody concentration is 1 mg/ml.
Description The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.
Characteristics Antigen Size: 593 amino acids
Molecular Weight 65kDa

Application Details

Application Notes WB Suggested Anti-PGBD3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives

Alternatives for antigen "PiggyBac Transposable Element Derived 3 (PGBD3)", type "Antibodies"
Hosts Rabbit (30)
Reactivities Human (28), Mouse (Murine) (4), Rat (Rattus) (4), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (15), ELISA (10), Immunohistochemistry (IHC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes N-Term (2), N-Term,AA 21-49 (1)