Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Myocyte Enhancer Factor 2A (MEF2A) antibody

Antigen

Myocyte Enhancer Factor 2A (MEF2A)

Synonyms ADCAD1, RSRFC4, RSRFC9, A430079H05Rik, wu:fd19d02, MEF2A, DKFZp469F0316, mef2a, MGC52609, xmef2a
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Mouse (Murine), Human, Pig (Porcine), Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183458
Quantity 100 µg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MEF2A
Gene ID MEF2A
UniProt Q6P8Q3
Immunogen The immunogen for anti-MEF2A antibody: synthetic peptide directed towards the N terminal of mouse MEF2A
Sequence ESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFS KLNEDSDFIF
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-MEF2A antibody concentration is 1 mg/ml.
Description MEF2a belongs to MEF2 family. Members of MEF2 family of transcription factors bind a conserved A/T-rich sequence in the control regions of numerous muscle-specific genes
Characteristics Antigen Size: 498 amino acids
Molecular Weight 55kDa

Application Details

Application Notes WB Suggested Anti-MEF2A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cardiovascular, Hypertrophy, Cardiogenesis, Transcription Factors, Neurogenesis
Restrictions For Research Use only

Publications

Product Naya, Black, Wu et al.: "Mitochondrial deficiency and cardiac sudden death in mice lacking the MEF2A transcription factor." in: Nature medicine, Vol. 8, Issue 11, pp. 1303-9, 2002 (PubMed).

Alternatives

Alternatives for antigen "Myocyte Enhancer Factor 2A (MEF2A)", type "Antibodies"
Hosts Rabbit (160), Mouse (8)
Reactivities Human (166), Mouse (Murine) (130), Rat (Rattus) (125), Cow (Bovine) (22), Dog (Canine) (22), Horse (Equine) (18), Chicken (3), Pig (Porcine) (3), Xenopus laevis (3), Zebrafish (2), Cat (Feline) (1), Rabbit (1)
Applications Immunofluorescence (IF) (87), Western Blotting (WB) (74), ELISA (46), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (42), Immunohistochemistry (IHC) (40), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (12), Immunocytochemistry (ICC) (9), Immunoprecipitation (IP) (9), Immunoelectron Microscopy (IEM) (4), Flow Cytometry (FACS) (1)
Conjugates Alexa Fluor 350 (4), Alexa Fluor 488 (4), Alexa Fluor 555 (4), Alexa Fluor 647 (4), Biotin (4), Cy3 (4), Cy5 (4), Cy5.5 (4), Cy7 (4), FITC (4), Gold (4), HRP (4), PE (4), PE,Cy3 (4), PE,Cy5 (4), PE,Cy5.5 (4), PE,Cy7 (4)
Epitopes pThr312 (29), pThr319 (29), pSer408 (28), C-Term (19), AA 487-507 (5), Internal Region (3), N-Term (3), Center (2), Internal Region,AA 459-488 (1), Met15 (1)