Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183485

Methylthioribose-1-Phosphate Isomerase Homolog (S. Cerevisiae) (Mri1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2410018C20Rik, M1Pi, zgc:172216, MRDI, MTNA, Ypr118w, RGD1307789, mtna
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183485
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-Mri1 antibody: synthetic peptide directed towards the N terminal of mouse 2410018C20RIK
Sequence LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRS IGDLGARHLL
Predicted Reactivity Mouse : 100%, Pig : 92%, Horse : 85%, Dog : 78%, Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against 2410018C20RIK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name Mri1
Background This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Molecular Weight 41kDa
Gene ID 67873
NCBI Accession NP_080699, NM_026423
UniProt Q9CQT1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-Mri1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).

Alternatives for antigen "Methylthioribose-1-Phosphate Isomerase Homolog (S. Cerevisiae) (Mri1)", type "Antibodies"
Hosts (8), (7)
Reactivities (13), (5), (3), (1), (1), (1), (1)
Applications (15), (4), (3), (3), (3), (2), (2)
Epitopes (3), (3), (2), (1)
Beacon