ISL LIM Homeobox 2 (ISL2) (C-Term) antibody

Details for Product No. ABIN183487
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3110001N10Rik, ISL-2, isl2, wu:fc29g02, zfIsl-2
Epitope
C-Term
(7), (4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Chicken, Human
(37), (23), (21), (14), (12), (2), (1), (1)
Host
Rabbit
(31), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (12), (10), (4), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN183487
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of mouse ISL2
Sequence VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGT PLVAGSPIGH
Predicted Reactivity Mouse : 100 %, Rat : 90 %, Chicken : 80 %, Guinea pig : 80 %, Human : 80 %, Rabbit : 80 %, Bovine : 70 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against ISL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ISL2
Background Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
Molecular Weight 39 kDa
Gene ID 104360
NCBI Accession NM_027397, NP_081673
UniProt Q9CXV0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ISL LIM Homeobox 2 (ISL2) (C-Term) antibody WB Suggested Anti-ISL2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Product cited in: Svärd, Heby-Henricson, Henricson et al.: "Genetic elimination of Suppressor of fused reveals an essential repressor function in the mammalian Hedgehog signaling pathway." in: Developmental cell, Vol. 10, Issue 2, pp. 187-97, 2006 (PubMed).

Hosts (31), (7)
Reactivities (37), (23), (21), (14), (12), (2), (1), (1)
Applications (26), (12), (10), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top