Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183487

ISL LIM Homeobox 2 (ISL2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 3110001N10Rik, ISL-2, isl2, wu:fc29g02, zfIsl-2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Chicken, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183487
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the C terminal of mouse ISL2
Sequence VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGT PLVAGSPIGH
Predicted Reactivity Mouse : 100%, Rat : 92%, Chicken : 85%, Guinea pig : 85%, Human : 85%, Rabbit : 85%, Bovine : 78%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against ISL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ISL2
Background Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
Molecular Weight 39kDa
Gene ID 104360
NCBI Accession NP_081673, NM_027397
UniProt Q9CXV0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ISL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Svärd, Heby-Henricson, Henricson et al.: "Genetic elimination of Suppressor of fused reveals an essential repressor function in the mammalian Hedgehog signaling pathway." in: Developmental cell, Vol. 10, Issue 2, pp. 187-97, 2006 (PubMed).

Alternatives for antigen "ISL LIM Homeobox 2 (ISL2)", type "Antibodies"
Hosts (29), (8)
Reactivities (36), (21), (19), (14), (12), (2), (1), (1)
Applications (25), (12), (10), (5), (3), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (4), (2), (1), (1), (1)
Beacon