DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16) antibody

Antigen: DEAH (Asp-Glu-Ala-His) Box Polypeptide 16 (DHX16)

Synonyms: DBP2, PRP8, DDX16, PRO2014, Ddx16, mKIAA0577, 2410006N22Rik, Dbp2, fa91b12, zgc:55590, wu:fa91b12, DHX16, dbp2, prp8, ddx16, pro2014, DKFZp459L1130

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine)

Application: Western Blotting (WB)

Catalog no.: ABIN183550

Additional Information

Alternative name: DHX16

Gene ID: DHX16

UniProt: O60231

Immunogen: The immunogen for anti-DHX16 antibody: synthetic peptide directed towards the N terminal of human DHX16

Sequence: KYQLVLEEEETIEFVRATQLQGDEEPSAPPTSTQAQQKES IQAVRRSLPV

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DHX16 antibody concentration is 1 mg/ml.

Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked.

Characteristics: Antigen Size: 1041 amino acids

Molecular Weight: 115kDa

Application Details

Application Notes: WB Suggested Anti-DHX16 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-DHX16 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).