ZFP589 (Middle Region) antibody

Details for Product No. ABIN183566
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
Middle Region
Reactivity
Human
(1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN183566
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZFP589
Sequence LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAF NQKSNLFRQK
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against ZFP589. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Background The function of Anti-ZFP589 has not yet been determined.
Molecular Weight 41 kDa
Gene ID 51385
NCBI Accession NM_016089
UniProt Q9Y611
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 361 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ZFP589 (Middle Region) antibody WB Suggested Anti-ZFP589 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Liu, Levenstein, Chen et al.: "SZF1: a novel KRAB-zinc finger gene expressed in CD34+ stem/progenitor cells." in: Experimental hematology, Vol. 27, Issue 2, pp. 313-25, 1999 (PubMed).

Hosts (1)
Reactivities (1)
Applications (1)
back to top