Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183566

ZFP589 (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183566
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP589 antibody: synthetic peptide directed towards the middle region of human ZFP589
Sequence LEIQLSPAQNASSEEVDRISKRAETPGFGAVRFGECALAF NQKSNLFRQK
Predicted Reactivity Human :100%
Characteristics This is a rabbit polyclonal antibody against ZFP589. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Background The function of Anti-ZFP589 has not yet been determined.
Molecular Weight 41kDa
Gene ID 51385
NCBI Accession AAD38880, NM_016089
UniProt Q9Y611
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP589 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Liu, Levenstein, Chen et al.: "SZF1: a novel KRAB-zinc finger gene expressed in CD34+ stem/progenitor cells." in: Experimental hematology, Vol. 27, Issue 2, pp. 313-25, 1999 (PubMed).

Alternatives for antigen "ZFP589", type "Antibodies"
Hosts (1)
Reactivities (1)
Applications (1)
Beacon