LIM Homeobox Transcription Factor 1, alpha (LMX1A) antibody

Antigen: LIM Homeobox Transcription Factor 1, alpha (LMX1A)

Synonyms: LMX1, LMX-1, LMX1.1, MGC87616, dr, sst, Lmx1.1, dreher, MGC129356, MGC129357

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Mouse (Murine), Rat (Rattus), Human

Application: Western Blotting (WB)

Catalog no.: ABIN183582

Additional Information

Alternative name: LMX1A

Gene ID: LMX1A

UniProt: Q9JKU8

Immunogen: The immunogen for anti-LMX1A antibody: synthetic peptide corresponding to a region of Mouse

Sequence: AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDS DDTSLSNLGD

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-LMX1A antibody concentration is 1 mg/ml.

Description: Lmx1a acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. It is required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.

Characteristics: Antigen Size: 382 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-LMX1A Antibody Titration: 5.0ug/ml
Positive Control: SP2/0 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Stem Cells, Transcription Factors, Neurogenesis

Restrictions: For Research Use only

Images

WB Suggested Anti-LMX1A Antibody Titration: 5.0ug/ml
Positive Control: SP2/0 cell lysate

Publications

Product: Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).