Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ring Finger Protein 1 (RING1) antibody

Antigen

Ring Finger Protein 1 (RING1)
Synonyms RNF1, RING1A
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN183627
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Ring Finger Protein 1 (RING1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name RING1 / RNF1
Gene ID RING1
UniProt Q06587
Immunogen The immunogen for anti-RING1 antibody: synthetic peptide directed towards the N terminal of human RING1
Sequence MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPR SLHSELMCPI
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-RING1 antibody concentration is 1 mg/ml.
Description RING1 can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in la
Characteristics Antigen Size: 406 amino acids
Molecular Weight 42kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-RING1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Ogawa, Ishiguro, Gaubatz et al.: "A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells." in: Science (New York, N.Y.), Vol. 296, Issue 5570, pp. 1132-6, 2002 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Ring Finger Protein 1 (RING1)", type "Antibodies"
Hosts Rabbit (39), Mouse (6)
Reactivities Human (44), Mouse (Murine) (25), Rat (Rattus) (25), Dog (Canine) (21), Cow (Bovine) (19), Pig (Porcine) (19), Chicken (18), Sheep (Ovine) (18)
Applications Western Blotting (WB) (29), ELISA (20), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (IHC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (5), C-Term (3), Internal Region (3)