Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SATB Homeobox 1 (SATB1) antibody

Antigen

SATB Homeobox 1 (SATB1)
Synonyms AW413156, 2610306G12Rik, SATB1, MGC165895
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Chicken, Human, Rat (Rattus), Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN183628
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-SATB Homeobox 1 (SATB1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name SATB1
Gene ID SATB1
UniProt Q01826
Immunogen The immunogen for anti-SATB1 antibody: synthetic peptide directed towards the C terminal of human SATB1
Sequence VDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEG NTDINTDLKD
Cross-Reactivity Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-SATB1 antibody concentration is 1 mg/ml.
Description SATB1 binds to DNA at special AT-rich sequences at nuclear matrix- or scaffold-associated regions. SATB1 was thought to recognize the sugar-phosphate structure of double-stranded DNA
Characteristics Antigen Size: 763 amino acids
Molecular Weight 86kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-SATB1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Green, Roeder: "Definition of a novel promoter for the major adenovirus-associated virus mRNA." in: Cell, Vol. 22, Issue 1 Pt 1, pp. 231-42, 1981 (PubMed).

Pavan Kumar, Purbey, Sinha et al.: "Phosphorylation of SATB1, a global gene regulator, acts as a molecular switch regulating its transcriptional activity in vivo." in: Molecular cell, Vol. 22, Issue 2, pp. 231-43, 2006 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "SATB Homeobox 1 (SATB1)", type "Antibodies"
Hosts Rabbit (44), Mouse (9), Goat (2)
Reactivities Human (54), Mouse (Murine) (35), Rat (Rattus) (30), Chicken (6), Cow (Bovine) (6), Dog (Canine) (5), Pig (Porcine) (5)
Applications Western Blotting (WB) (33), ELISA (18), Flow Cytometry (FACS) (16), Immunofluorescence (IF) (11), Immunohistochemistry (IHC) (11), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunocytochemistry (ICC) (3), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (2), Alexa Fluor 488 (2), Alexa Fluor 555 (2), Alexa Fluor 647 (2), PE,Cy5.5 (2), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1)
Epitopes Transcript Variant 1 (7), C-Term (6), pSer47 (4), N-Term (3), Internal Region (1), Middle Region (1), pSer244,pSer240 (1)