Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183642

Zinc Finger Protein 282 (ZNF282) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HUB1, Znf282
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183642
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF282 antibody: synthetic peptide directed towards the N terminal of human ZNF282
Sequence QQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEG MPPMQAQEWD
Predicted Reactivity Human : 100%, Rabbit : 100%, Dog : 92%, Guinea pig : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against ZNF282. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF282
Background ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat.
Molecular Weight 74kDa
Gene ID 8427
NCBI Accession NP_003566, NM_003575
UniProt Q9UDV7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF282 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 282 (ZNF282)", type "Antibodies"
Hosts (4)
Reactivities (5), (1), (1), (1), (1), (1)
Applications (5)
Epitopes (2), (1)
Beacon